Table 1.

Alignment of L221 residue of RPA1 subunit from various species

Species, accession numberStartSequenceStop
Homo sapiens NP_002936.1183KVVPIASLTPYQSKWTICARVTNKSQIRTWSNSR-GEGKLFSLELVD-ESG231
Pan troglodytes XP_511254.2237KVVPIASLTPYQSKWTICARVTNKSQIRTWSNSR-GEGKLFSLELVD-ESG285
Canis lupus familiaris XP_868487.1181KVVPIASLTPYQSKWTICARVTNKSQIRTWSNSR-GEGKLFSIELVD-ESG229
Bos taurus NP_001068644.1183KVVPIASLTPYQSKWTICARVTNKSQIRTWSNSR-GEGKLFSIELVD-ESG231
Mus musculus NP_080929.1192KVVPIASLTPYQSKWTICARVTNKSQIRTWSNSR-GEGKLFSLELVD-ESG240
Rattus norvegicus XP_213389.4183KVVPIASLTPYQSKWTICARVTNKSQIRTWSNSR-GEGKLFSIELVD-ESG231
Gallus gallus NP_001006221.1180KVVPIASLNPYQSKWTICARVTQKGQIRTWSNSR-GEGKLFSIELVD-ESG228
Danio rerio NP_956105.2170KVVPIASLNPYQSKWTIRARVTNKSAIRTWSNSR-GDGKLFSMELVD-ESG218
Drosophila melanogaster NP_524274.1168- - -PISSLSPYQNKWVIKARVTSKSGIRTWSNAR-GEGKLFSMDLMD-ESG213
Anopheles gambiae XP_321709.3179- - -PISSLSPYQNKWVIKARVMSKSGIRTWSNAK-GEGKLFSMDVMD-ESG224
Schizosaccharomyces pombe NP_595092.1178IIYPIEGLSPYQNKWTIRARVTNKSEVKHWHNQR-GEGKLFSVNLLD-ESG226
Saccharomyces cerevisiae NP_009404.1183PIFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQR-GDGKLFNVNFLD-TSG231
Kluyveromyces lactis XP_451388.1187PIFAIEQISPYQNNWTIKARVSFKGDLKKWQNNR-GEGHILNVNLLD-SSG235
Eremothecium gossypii NP_985540.1261PIFAIEQLSPYQNMWTIKARVSFKGDIKTWHNQR-GEGKLFNVNFLD-TSG309
Magnaporthe grisea XP_368559.1178NIYPIESISPYQHKWTIKARVSQKSDIRTWHKAS-GEGKLFSVNLLD-ETG226
Neurospora crassa XP_322908.1173TIYPIEGLSPFSHKWTIKARVTSKSDIKTWHKAS-GEGKLFSVNFLD-ESG221
Arabidopsis thaliana NP_567576.2227KIIPVNALSPYSGRWTIKARVTNKAALKQYSNPR-GEGKVFNFDLLDADGG276
Arabidopsis thaliana NP_199353.1298RINPIAALNPYQGRWTIKVRVTSKADLRRFNNPR-GEGKLFSFDLLDADGG347
Oryza sativa NP_001054445.1306RIIPITALNPYQPKWTIKARVTAKSDIRHWSNAR-SSGTVFSFDLLDAQGG355
Cryptosporidium parvum(short) AAD42062.11MPIREVNVNRQTISIKGRIIQKSSLQIL- - -K-SGLRFFHLDIIDKDND45
Cryptosporidium parvum(long) AAW71479.1191PVYPIKNITSYLHRWRIVGRVVSKSDIRKFSSSKTKEGKVFSFEICDADGS240

NOTE: Selected residues of DBD-A in RPA1 from various organisms are shown. L221 and the homologous residues are in bold.